GET /api/protein/UniProt/A0A1B2AJ28/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B2AJ28",
"id": "A0A1B2AJ28_DROME",
"source_organism": {
"taxId": "7227",
"scientificName": "Drosophila melanogaster",
"fullName": "Drosophila melanogaster (Fruit fly)"
},
"name": "Essential MCU regulator, mitochondrial",
"description": [
"Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria"
],
"length": 97,
"sequence": "MIVPRLALPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDED",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0036444",
"name": "calcium import into the mitochondrion",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0051560",
"name": "mitochondrial calcium ion homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1990246",
"name": "uniplex complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "df05179c7f30767e4cfd98dada4d48eaed7ae415",
"counters": {
"domain_architectures": 1265,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1265
}
}
}