GET /api/protein/UniProt/A0A1B1R143/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B1R143",
"id": "A0A1B1R143_9NEOP",
"source_organism": {
"taxId": "218760",
"scientificName": "Pyrgus malvae",
"fullName": "Pyrgus malvae (grizzled skipper)"
},
"name": "Alpha-1,4 glucan phosphorylase",
"description": [
"Allosteric enzyme that catalyzes the rate-limiting step in glycogen catabolism, the phosphorolytic cleavage of glycogen to produce glucose-1-phosphate, and plays a central role in maintaining cellular and organismal glucose homeostasis"
],
"length": 128,
"sequence": "TLQDIIRRYKSSKFGCRDAVRTTFDSLPDKVAIQLNDTHPALAIPELLRILLDIEKLPYDEAWNLVVKCCAYTNHTVLPEALERWPCSMLENVLPRHMQLIYHINFLHLQEVQKRWPNDVDRMRRMSL",
"proteome": null,
"gene": "Glyp",
"go_terms": [
{
"identifier": "GO:0008184",
"name": "glycogen phosphorylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "518c2dba2194a3fd4cbfa9bc0873221b3069410e",
"counters": {
"domain_architectures": 26195,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26195
}
}
}