GET /api/protein/UniProt/A0A1B0PIB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B0PIB8",
"id": "A0A1B0PIB8_BOACO",
"source_organism": {
"taxId": "1537908",
"scientificName": "Boa constrictor orophias",
"fullName": "Boa constrictor orophias"
},
"name": "Brain-derived neurotrophic factor",
"description": [
"Promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it"
],
"length": 235,
"sequence": "MVISYLSCMKAAPMKEVSIRGQGSLAYPGLRTQGNLETLGGPNDATRGLTSLADTFEHVIEELLDEQQVIQPSKENKDADLYSTRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYFYETKCSSKGYAKEGCRGIDKRYWNSQCRTTQSFVRALTMDNKKRVGWRFIRIDTSCVCTLTI",
"proteome": null,
"gene": "BDNF",
"go_terms": [
{
"identifier": "GO:0005102",
"name": "signaling receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "14e7fbcc4dc6e965afe2e82a5cba6c0dea182441",
"counters": {
"domain_architectures": 10537,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"prints": 2,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10537
}
}
}