GET /api/protein/UniProt/A0A1A8V1K2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1A8V1K2",
"id": "A0A1A8V1K2_NOTFU",
"source_organism": {
"taxId": "105023",
"scientificName": "Nothobranchius furzeri",
"fullName": "Nothobranchius furzeri (Turquoise killifish)"
},
"name": "Zinc finger MYND domain-containing protein 10",
"description": [
"Plays a role in axonemal structure organization and motility. Involved in axonemal pre-assembly of inner and outer dynein arms (IDA and ODA, respectively) for proper axoneme building for cilia motility. May act by indirectly regulating transcription of dynein proteins"
],
"length": 382,
"sequence": "LGKIPVLVHEMILVEVWKQKVFPIMCQLQDFKPKNTFHLYMVIHHEATIINLLETIMFHKDSCEAADDSLLDLVDYCHRKLTLLASEATKGSAVTHDQHNQISFIEELQMQKAALEFDISLKAVSVLRYITEHADSISVINRMLCTHNVPCVLVQLIDSCPWGRCNKGEVQKYIKGKWQTIPAEDHLKITTLDGQVWLSLYNLLLREECQRKYDFNSFNKSQLLRLRGFLTEVLVDQLPNLVELQRFLAHLAVTEPAPPKKELILEQIPKIWSYIAKENAGKWKAIAKYQVKETFSLSDSDLRQQAQRLAQTYNLDVMEGLIPEKPKCGSCGREAAKRCSRCQKEWYCHRECQVKHWEKHKKACQLMADAVEKIQEERLMKS",
"proteome": null,
"gene": "ZMYND10",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1ec3c32d1b06847ab77b1473a81c4eb0d3dfdbeb",
"counters": {
"domain_architectures": 28531,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 28531
}
}
}