GET /api/protein/UniProt/A0A1A8V1K2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1A8V1K2",
        "id": "A0A1A8V1K2_NOTFU",
        "source_organism": {
            "taxId": "105023",
            "scientificName": "Nothobranchius furzeri",
            "fullName": "Nothobranchius furzeri (Turquoise killifish)"
        },
        "name": "Zinc finger MYND domain-containing protein 10",
        "description": [
            "Plays a role in axonemal structure organization and motility. Involved in axonemal pre-assembly of inner and outer dynein arms (IDA and ODA, respectively) for proper axoneme building for cilia motility. May act by indirectly regulating transcription of dynein proteins"
        ],
        "length": 382,
        "sequence": "LGKIPVLVHEMILVEVWKQKVFPIMCQLQDFKPKNTFHLYMVIHHEATIINLLETIMFHKDSCEAADDSLLDLVDYCHRKLTLLASEATKGSAVTHDQHNQISFIEELQMQKAALEFDISLKAVSVLRYITEHADSISVINRMLCTHNVPCVLVQLIDSCPWGRCNKGEVQKYIKGKWQTIPAEDHLKITTLDGQVWLSLYNLLLREECQRKYDFNSFNKSQLLRLRGFLTEVLVDQLPNLVELQRFLAHLAVTEPAPPKKELILEQIPKIWSYIAKENAGKWKAIAKYQVKETFSLSDSDLRQQAQRLAQTYNLDVMEGLIPEKPKCGSCGREAAKRCSRCQKEWYCHRECQVKHWEKHKKACQLMADAVEKIQEERLMKS",
        "proteome": null,
        "gene": "ZMYND10",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1ec3c32d1b06847ab77b1473a81c4eb0d3dfdbeb",
        "counters": {
            "domain_architectures": 28531,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28531
        }
    }
}