General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1A8UT25",
        "id": "A0A1A8UT25_NOTFU",
        "source_organism": {
            "taxId": "105023",
            "scientificName": "Nothobranchius furzeri",
            "fullName": "Nothobranchius furzeri (Turquoise killifish)"
        },
        "name": "Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma",
        "description": [
            "Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones"
        ],
        "length": 86,
        "sequence": "MNASPPAGSALAPGGATGPTTPKKGPPKFKQRQTRTFKSKAPKPGQKGFGDDIPGMEGLGTDITVVCPWEAFGDMELSDLAKYGII",
        "proteome": "UP000694548",
        "gene": "OLA.6437",
        "go_terms": [
            {
                "identifier": "GO:0004114",
                "name": "3',5'-cyclic-nucleotide phosphodiesterase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030553",
                "name": "cGMP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007601",
                "name": "visual perception",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d843fd2591409e9891624b91b9308b7a0330a126",
        "counters": {
            "domain_architectures": 2252,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2252
        }
    }
}