GET /api/protein/UniProt/A0A1A8ARD6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1A8ARD6",
"id": "A0A1A8ARD6_NOTFU",
"source_organism": {
"taxId": "105023",
"scientificName": "Nothobranchius furzeri",
"fullName": "Nothobranchius furzeri (Turquoise killifish)"
},
"name": "Draxin",
"description": [
"Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord"
],
"length": 364,
"sequence": "MALSWRLLLAFLFAILALSHGADPGAPYDKRRKAQTSAGGSNALQYPPQAQQRPSYNRDRSQRSRSKAGAGLLSHRTLHPLPRPEDDGTGLEGLSPVRVETGPSRDRARQSLKSRPMAQENQLLGMQMGGGNRHGHPFEYKRQGSRRDKMRHRKGFPSEPELSAALKDRDRFEDSPPSLSSSTTSPSLSMTPPIEPPSPIISLLGSGSSVVTTATNEHPPTLPPASTKPQRQGQGEVMPTLDMALFDWTDYEDMKPVDTWPSSKKKDKRRSKNLSSGNMTVGGGAVEPCDHHLDCLPGSCCDLRQHECTPHNRGLNNKCYDDCMCEEGFRCYAKFHRKRRVTRRRGRCVAPDSVSSDHGGFITI",
"proteome": "UP000694548",
"gene": "DRAXIN",
"go_terms": [
{
"identifier": "GO:0007411",
"name": "axon guidance",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016055",
"name": "Wnt signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e1ae81c6d437974d34da9dbf83cb2f6cfe45d4ba",
"counters": {
"domain_architectures": 938,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 938
}
}
}