GET /api/protein/UniProt/A0A1A8ARD6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1A8ARD6",
        "id": "A0A1A8ARD6_NOTFU",
        "source_organism": {
            "taxId": "105023",
            "scientificName": "Nothobranchius furzeri",
            "fullName": "Nothobranchius furzeri (Turquoise killifish)"
        },
        "name": "Draxin",
        "description": [
            "Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord"
        ],
        "length": 364,
        "sequence": "MALSWRLLLAFLFAILALSHGADPGAPYDKRRKAQTSAGGSNALQYPPQAQQRPSYNRDRSQRSRSKAGAGLLSHRTLHPLPRPEDDGTGLEGLSPVRVETGPSRDRARQSLKSRPMAQENQLLGMQMGGGNRHGHPFEYKRQGSRRDKMRHRKGFPSEPELSAALKDRDRFEDSPPSLSSSTTSPSLSMTPPIEPPSPIISLLGSGSSVVTTATNEHPPTLPPASTKPQRQGQGEVMPTLDMALFDWTDYEDMKPVDTWPSSKKKDKRRSKNLSSGNMTVGGGAVEPCDHHLDCLPGSCCDLRQHECTPHNRGLNNKCYDDCMCEEGFRCYAKFHRKRRVTRRRGRCVAPDSVSSDHGGFITI",
        "proteome": "UP000694548",
        "gene": "DRAXIN",
        "go_terms": [
            {
                "identifier": "GO:0007411",
                "name": "axon guidance",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016055",
                "name": "Wnt signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1ae81c6d437974d34da9dbf83cb2f6cfe45d4ba",
        "counters": {
            "domain_architectures": 938,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 938
        }
    }
}