General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1A6GXH3",
        "id": "A0A1A6GXH3_NEOLE",
        "source_organism": {
            "taxId": "56216",
            "scientificName": "Neotoma lepida",
            "fullName": "Neotoma lepida (Desert woodrat)"
        },
        "name": "Biogenesis of lysosome-related organelles complex 1 subunit 1",
        "description": [
            "Acts as a protein acetyltransferase. Negatively regulates aerobic respiration through mitochondrial protein lysine-acetylation. May counteract the action of the deacetylase SIRT3 by acetylating and regulating proteins of the mitochondrial respiratory chain including ATP5F1A and NDUFA9. Acts as a regulator of mTORC2 signaling in response to hypotoxic stress by mediating acetylation of RICTOR, thereby protecting RICTOR against ubiquitination and subsequent degradation by the proteasome"
        ],
        "length": 125,
        "sequence": "MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS",
        "proteome": "UP000092124",
        "gene": "A6R68_00425",
        "go_terms": [
            {
                "identifier": "GO:0031083",
                "name": "BLOC-1 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f7955efde020a704b2126ecc1b601c259896d218",
        "counters": {
            "domain_architectures": 3162,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3162
        }
    }
}