GET /api/protein/UniProt/A0A194Q3J5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A194Q3J5",
"id": "A0A194Q3J5_PAPXU",
"source_organism": {
"taxId": "66420",
"scientificName": "Papilio xuthus",
"fullName": "Papilio xuthus (Asian swallowtail butterfly)"
},
"name": "ADP-ribosylation factor-related protein 1",
"description": [
"Trans-Golgi-associated GTPase that regulates protein sorting. Controls the targeting of ARL1 and its effector to the trans-Golgi. Required for the lipidation of chylomicrons in the intestine and required for VLDL lipidation in the liver"
],
"length": 192,
"sequence": "MVQKDEYCVLILGLDNAGKTTYLEATKTKYTKKYKAMNPNRITTTVGLNIGKIDVDAVRLSFRDLGGQQELQSLWDKYYAECHAVIYIVDSSDRERISESKETFDKMIASEHLSGVPLLVLANKQDIPDCMGVHTVKPIFNQNAHLIGARDIMLMATSALTGDGVDEGIRWLVDCIKRNSVDRPPRNHDDKL",
"proteome": "UP000053268",
"gene": "RR46_02900",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6bc1331c4b416e231f52943c4822a3a2b702855",
"counters": {
"domain_architectures": 72767,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 2,
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 1,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 72767
}
}
}