GET /api/protein/UniProt/A0A179UNA3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A179UNA3",
        "id": "A0A179UNA3_BLAGS",
        "source_organism": {
            "taxId": "559298",
            "scientificName": "Blastomyces gilchristii (strain SLH14081)",
            "fullName": "Blastomyces gilchristii (strain SLH14081)"
        },
        "name": "Cytochrome b5 heme-binding domain-containing protein",
        "description": null,
        "length": 251,
        "sequence": "MIRGYLQHRNRIPSSPIASGPTAVTPPHSRSGSGWQPLVVVPSKARSSGLGATELIIAIRTLKKDPYSQATFCVNSLAHLLGEQPFDDRNSPRDHVVTALVTLGEGYHNFHHEFPSDYRNAIEWHQYYPTKWTIWLWKQVGLAHHLKQFRANEIERGRLQQLQQLQQLQKQVDRRRIQLDWGRSLEELPVMEWEEYVDRAKKRGLVAIAGLVHDVTGFIKEHPGGKAMIQSGIGKDATAIFNGGVYNHSTE",
        "proteome": "UP000002038",
        "gene": "BDBG_03919",
        "go_terms": [
            {
                "identifier": "GO:0016717",
                "name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5f7e0df0a2a0d53f1ed7a673e5e103c65f26d048",
        "counters": {
            "domain_architectures": 33201,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33201
        }
    }
}