General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A178ZK22",
        "id": "A0A178ZK22_9EURO",
        "source_organism": {
            "taxId": "1367422",
            "scientificName": "Fonsecaea erecta",
            "fullName": "Fonsecaea erecta"
        },
        "name": "Acyl-CoA desaturase",
        "description": [
            "Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates"
        ],
        "length": 480,
        "sequence": "MPSSQPTAGDLAVKPEFQSSQPTPMAKPSEPNRSTKYDPKKIHITEMPMTRSNWYKHVNWLNVTLIVGIPLWGCIQAFWTPLQVKTAVWAVLYYFATGLGITAGYHRLWAHTSYSATLPLRVFLAAVGGGAVEGSIRWWSRDHRAHHRYTDTEKDPYSVRKGLLYSHIGWMVMKQNPKRIGRTDISDLNEDPIVVWQHKNYLKVVIFMGLILPTIVAGLGWGDWWGGFIYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWFIWTCKQLGLAYDLKQFRSNEIEKGRLQQQQKKLDQKRAKLDWGVPLDQLPVMEWDDYVDQCKNGRGLIAIAGIVHDVTDFIKDHPGGKAMIGSGVGKDATAVFNGGVYMHSNAAHNLLSTMRVGVIRGGGEVDIWRRSQLEAKGEVSRDSSGERIIRAGYQPTKVLQNTPTAGAA",
        "proteome": "UP000078343",
        "gene": "AYL99_04833",
        "go_terms": [
            {
                "identifier": "GO:0016717",
                "name": "oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004768",
                "name": "stearoyl-CoA 9-desaturase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006636",
                "name": "unsaturated fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6391b15d3a0d490e2b6a9a7ff891e4d7f44df7a5",
        "counters": {
            "domain_architectures": 3144,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "prints": 2,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3144
        }
    }
}