General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A178V8H2",
        "id": "A0A178V8H2_ARATH",
        "source_organism": {
            "taxId": "3702",
            "scientificName": "Arabidopsis thaliana",
            "fullName": "Arabidopsis thaliana (Mouse-ear cress)"
        },
        "name": "7,8-dihydroneopterin aldolase",
        "description": [
            "Catalyzes the conversion of 7,8-dihydroneopterin into 6-hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate. Can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin, but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin",
            "Catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin"
        ],
        "length": 146,
        "sequence": "MHSSLETTAPATLERRESNLGDKLILKGLKFYGFHGAIAEERTLGQMFLVDIDAWVSLKKAGESDNLEDTISYVDIFSLAKEIVEGSPRNLLETVAELIASKTLEKFHQINAVRVKLSKPNVALIKSTIDYLGVDIFRQRNTSSKN",
        "proteome": null,
        "gene": "AXX17_At3g11690",
        "go_terms": [
            {
                "identifier": "GO:0004150",
                "name": "dihydroneopterin aldolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006760",
                "name": "folic acid-containing compound metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b92a05b3daf9e1c5651b9474330a42b7578a9918",
        "counters": {
            "domain_architectures": 24039,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "ncbifam": 2,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 24039
        }
    }
}