GET /api/protein/UniProt/A0A177ZKW8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A177ZKW8",
        "id": "A0A177ZKW8_9BACI",
        "source_organism": {
            "taxId": "217031",
            "scientificName": "Lederbergia galactosidilytica",
            "fullName": "Lederbergia galactosidilytica"
        },
        "name": "Beta-ketoacyl-[acyl-carrier-protein] synthase III",
        "description": [
            "Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Has some substrate specificity for branched chain acyl-CoA, determining the biosynthesis of branched-chain of fatty acids instead of straight-chain",
            "Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids"
        ],
        "length": 327,
        "sequence": "MLQSKTKVTAIGTAVPDKRLLNADLEKMVETSDEWIVQRTGMKERRIAGENEFASTLAFRAVNNLIQNYDKDLHDVDGIIVATTTPDYAFPSVACQIQAHFQIPCTGAFDLNATCAGFTYALHVANNLITSEAHKKILVVATETLSKVTDYQDRSTCILFGDGAAAMLLEYDEENPSFLASHMGTDGNGGIHVYRTTLASTMNNTALNTSGKMVQNGREVYKWAVRTIPDSMRTLADKAQLTFADIDWFIPHSANLRMIESICEKSGFPIEKSLTSVKCFGNTSSASIPLALQIGIENGQVQTGDTLMVYGFGGGLTHLGLILKWDV",
        "proteome": "UP000077881",
        "gene": "fabH",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004315",
                "name": "3-oxoacyl-[acyl-carrier-protein] synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006633",
                "name": "fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f650d7454ccec3fefdcbdcad813648104ddb697c",
        "counters": {
            "domain_architectures": 45931,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 45931
        }
    }
}