HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A166IQG6",
"id": "A0A166IQG6_NODSP",
"source_organism": {
"taxId": "1819295",
"scientificName": "Nodularia spumigena CENA596",
"fullName": "Nodularia spumigena CENA596"
},
"name": "Small ribosomal subunit protein uS5",
"description": [
"Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body",
"With S4 and S12 plays an important role in translational accuracy"
],
"length": 174,
"sequence": "MATGRRKANRTKKEETTWQERVIQIRRVSKVVKGGKKLSFRAIVVVGNERGQVGVGVGKASDVIGAVKKGVADGKKHLIDIPMTKSNSIPHPIDGVGGGAKVMMRPAAPGTGVIAGGAVRTVLELAGVRNILAKQLGSNNPLNNARAAVNALSTLRTLSEVAEDRGIPIEKLYI",
"proteome": null,
"gene": "rpsE",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015935",
"name": "small ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ddb47877d1b64f864fa25e376c154e201459d42b",
"counters": {
"domain_architectures": 34638,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"profile": 1,
"pfam": 2,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 34638
}
}
}