GET /api/protein/UniProt/A0A166FLZ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A166FLZ6",
        "id": "A0A166FLZ6_DAUCS",
        "source_organism": {
            "taxId": "79200",
            "scientificName": "Daucus carota subsp. sativus",
            "fullName": "Daucus carota subsp. sativus (Carrot)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters"
        ],
        "length": 113,
        "sequence": "MRKPGAYSGLLSGSISGPHLLPLARIKKIMKKSNDDVKMISGEAPIVFSKACELFIEELTKRSWNMTMQAKRRTLHKEDVAAAVVATEIFDFLVPIVSVDDDGEDGIEKKEES",
        "proteome": "UP000077755",
        "gene": "DCAR_0100375",
        "go_terms": [
            {
                "identifier": "GO:0046982",
                "name": "protein heterodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6df952aa255ac470bf7b0d945c8fb5d61ae9c767",
        "counters": {
            "domain_architectures": 32824,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32824
        }
    }
}