General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A165UFC4",
        "id": "A0A165UFC4_9AGAM",
        "source_organism": {
            "taxId": "1314782",
            "scientificName": "Neolentinus lepideus HHB14362 ss-1",
            "fullName": "Neolentinus lepideus HHB14362 ss-1"
        },
        "name": "Oxidized purine nucleoside triphosphate hydrolase",
        "description": [
            "Oxidized purine nucleoside triphosphate hydrolase which is a prominent sanitizer of the oxidized nucleotide pool. Catalyzes the hydrolysis of 2-oxo-dATP (2-hydroxy-dATP) into 2-oxo-dAMP. Also has a significant hydrolase activity toward 2-oxo-ATP, 8-oxo-dGTP and 8-oxo-dATP. Through the hydrolysis of oxidized purine nucleoside triphosphates, prevents their incorporation into DNA and the subsequent transversions A:T to C:G and G:C to T:A. Also catalyzes the hydrolysis of methylated purine nucleoside triphosphate preventing their integration into DNA. Through this antimutagenic activity protects cells from oxidative stress"
        ],
        "length": 189,
        "sequence": "MDNITPYSEGGEGDWLLFEQRKYFTNAFIVQHDNKRILLGLKKRGFGKDKYNGFGGKVEDGETSAEAAVRELQEEAGITAALEYSGTMLFFSEGSDFAYHIDYYSAAAYQGTVTETEEMRPEWFALPDVDATEPSTLPQIPFHQMWEDDHIWFPLLIAKRIFNGRVDFRLDANSQHKLTKWWFGAASAS",
        "proteome": "UP000076761",
        "gene": "NEOLEDRAFT_1087660",
        "go_terms": [
            {
                "identifier": "GO:0008413",
                "name": "8-oxo-7,8-dihydroguanosine triphosphate pyrophosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042262",
                "name": "DNA protection",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "752b3b6d9807717ea1f029db1420a2538cb188ca",
        "counters": {
            "domain_architectures": 250306,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 250306
        }
    }
}