General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A160MIM7",
        "id": "A0A160MIM7_9BACI",
        "source_organism": {
            "taxId": "1196031",
            "scientificName": "Cytobacillus oceanisediminis 2691",
            "fullName": "Cytobacillus oceanisediminis 2691"
        },
        "name": "Probable nitronate monooxygenase",
        "description": [
            "Nitronate monooxygenase that uses molecular oxygen to catalyze the oxidative denitrification of alkyl nitronates. Acts on propionate 3-nitronate (P3N), the presumed physiological substrate. Probably functions in the detoxification of P3N, a metabolic poison produced by plants and fungi as a defense mechanism"
        ],
        "length": 317,
        "sequence": "MRFPQLRIGHMKPEFPIMQGGMGVGISLSGLSSAVANAGGIGTISGTGISIEDLRLHIRKAKASIKGEGYIGVNVLFAMNDFAEKMKTAIEEKVDFIISGAGISRDMYSWGRESGIPVISIVSSARLAKMSERLGASAVVVEGNEAGGHLGTKRPLFNILQEVVEAVKIPVIAAGGIMTGRDIAHAIRIGASGVQMGTRFVASRECDAPLSFKEKYVRAKQEDIVMVKTTVGLEGRAIKNHFTEQIADNKKVKIKNCIDCLKNCSYRFCTMDSLITSMDGDCENGLVFAGARVHEIKEILPVQTIINNLKAEYEAFV",
        "proteome": null,
        "gene": "A361_03495",
        "go_terms": [
            {
                "identifier": "GO:0018580",
                "name": "nitronate monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4a69606a3a9c0ce277064c7394fb6cae5fe264df",
        "counters": {
            "domain_architectures": 41797,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 41797
        }
    }
}