General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A154P107",
        "id": "A0A154P107_DUFNO",
        "source_organism": {
            "taxId": "178035",
            "scientificName": "Dufourea novaeangliae",
            "fullName": "Dufourea novaeangliae (Sweat bee)"
        },
        "name": "Signal peptidase complex subunit 1",
        "description": [
            "Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Dispensable for SPC enzymatic activity"
        ],
        "length": 95,
        "sequence": "MSSWVQYIKTIPTHMDYDGQARVENLSRVIITLFGVVGLIWGYVIQQFSQTIYILGAGFVMAALITVPPWPMYRRKPLDWQKPQPDVNVKSKKKK",
        "proteome": "UP000076502",
        "gene": "WN55_09727",
        "go_terms": [
            {
                "identifier": "GO:0006465",
                "name": "signal peptide processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005787",
                "name": "signal peptidase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c6fe7d52f41a35a0873d285c39adf6638dc7ea3a",
        "counters": {
            "domain_architectures": 5126,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5126
        }
    }
}