GET /api/protein/UniProt/A0A151MTR2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A151MTR2",
"id": "A0A151MTR2_ALLMI",
"source_organism": {
"taxId": "8496",
"scientificName": "Alligator mississippiensis",
"fullName": "Alligator mississippiensis (American alligator)"
},
"name": "Eukaryotic translation initiation factor 3 subunit J",
"description": [
"Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation"
],
"length": 254,
"sequence": "MAAEADSWDADTFEAADPAAKPLVPGVGVDRWAGEDEEDDVKDNWDDEEEEEEEEEVKETEVKQETKVSEKKKIAEKIKEKERQLKKKQEEIKKRLEVPEEPKELTPEEQVADKLRLKKLQEEADLELAKETFGVNNTCGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLHYASFLETLVRDVCISLEVDDLKKITNSLTVLCSEKQKQEKQSKARKKKKGVVPGGGLKATMKDDLADYGGYDGEYVQDFEDFM",
"proteome": "UP000050525",
"gene": "EIF3J",
"go_terms": [
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005852",
"name": "eukaryotic translation initiation factor 3 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "68298d9205620ad7e8867b1ce92ada56e895b35e",
"counters": {
"domain_architectures": 4806,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4806
}
}
}