General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A151I4S3",
        "id": "A0A151I4S3_9HYME",
        "source_organism": {
            "taxId": "520822",
            "scientificName": "Atta colombica",
            "fullName": "Atta colombica"
        },
        "name": "KAT8 regulatory NSL complex subunit 2",
        "description": [
            "Non-catalytic component of the NSL histone acetyltransferase complex, a multiprotein complex that mediates histone H4 acetylation at 'Lys-5'- and 'Lys-8' (H4K5ac and H4K8ac) at transcription start sites and promotes transcription initiation. Required for NSL complex stability and for transcription of intraciliary transport genes in both ciliated and non-ciliated cells by regulating histone H4 acetylation at 'Lys-5'- and 'Lys-12' (H4K5ac and H4K12ac). This is necessary for cilium assembly in ciliated cells and for organization of the microtubule cytoskeleton in non-ciliated cells. Required within the NSL complex to maintain nuclear architecture stability by promoting KAT8-mediated acetylation of lamin LMNA"
        ],
        "length": 471,
        "sequence": "MFRIPKSTMPVPTATIITKRSKQAQSCLYASYECTQSSLEGYSYCAKHILEDSNAPYKQCAFVYNTNGRKCQNPAPKLDRRDVSYCGEHSRKAQIARIKSTSRRSLPETPEMLLLNLSHYIKPVDSAAEDTEEEKRKVKALDPFTEVDAYRVNASGSDILDYASSSESDVEPTVVTDTLRGVHLDDSDNESLHSPQEDPLKHAGIFTAEEVIYIAREKLIRLQSLYIDQFRRLQYILKEKRRKYLLALKKEKETLCSIYSQKRETAKEKKLYEKLKALNRYHRRSGVEAILYRKSLERRAQVTEPIQKPPNISKCVFTEGGVKCGERTLPSAKHCRKHILKDQHQVLFKACGAVRADIECHEPVPVIFDSNCVFHMNLPPPCKLEPMKFEEEKPVKQEASMIDNQSMEIDVVGEAQEIDPDDDMAGLMREMNDSINLKPSFANESLNSETSTDTAFSLSAQMSDRDDFVTV",
        "proteome": "UP000078540",
        "gene": "ALC53_04273",
        "go_terms": [
            {
                "identifier": "GO:0000123",
                "name": "histone acetyltransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0ab69d8daa9d3cebbd9cac34da53dab3afdacd7a",
        "counters": {
            "domain_architectures": 2016,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2016
        }
    }
}