GET /api/protein/UniProt/A0A149PMZ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A149PMZ2",
        "id": "A0A149PMZ2_9BURK",
        "source_organism": {
            "taxId": "1399968",
            "scientificName": "Paraburkholderia monticola",
            "fullName": "Paraburkholderia monticola"
        },
        "name": "Dual-specificity RNA methyltransferase RlmN",
        "description": [
            "Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. m2A2503 modification seems to play a crucial role in the proofreading step occurring at the peptidyl transferase center and thus would serve to optimize ribosomal fidelity"
        ],
        "length": 383,
        "sequence": "MTSSPSVNLLDLDAQGLVAYCDSLGEKPFRAKQLQRWIHQYNAADFDGMTDLAKSLREKLKGRASITMPGVVSDHVSSDGTRKWLIDVGNGNAVETVYIPEETRGTLCVSSQAGCAVNCRFCSTGKQGFSRNLTTGEIIGQLRMAEFALRASRGDAGGRAMGGDGKGERVVTNVVMMGMGEPLLNYDAVVPAMRLMLDDNAYGLSRRRVTLSTSGVVPMMDRLGADLPVALAVSLHAPNDALRDELVPLNKKYPLRELMAACERYLKVAPRDFITFEYCMLDGVNDSEAHARELLAVTRNVPCKFNLIPFNPFPESGLIRSKSEQIKRFAQVLMDAGVVTTVRKTRGDDIDAACGQLAGAVKDRTRLAERTGKAAKVIEVRAV",
        "proteome": "UP000075613",
        "gene": "rlmN",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030488",
                "name": "tRNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0070475",
                "name": "rRNA base methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c13ed286dda33645f2740866658bbdc34c2d4ac8",
        "counters": {
            "domain_architectures": 21482,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 1,
                "sfld": 3,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21482
        }
    }
}