GET /api/protein/UniProt/A0A147KD33/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A147KD33",
        "id": "A0A147KD33_THECS",
        "source_organism": {
            "taxId": "665004",
            "scientificName": "Thermobifida cellulosilytica TB100",
            "fullName": "Thermobifida cellulosilytica TB100"
        },
        "name": "cytochrome-c oxidase",
        "description": [
            "Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B)"
        ],
        "length": 270,
        "sequence": "MPEPITEQAERVLTLWQGSWVAAFAVGILVWGLIIWSVIAHRKRSEQLPPQVRYNMPIEALYTVLPIIVISVLFYFTARDQTYLLETDEPADVYVDVNAFQWSWQFTYEKELDVNGNPVSVAGVPSTSKDELPVLVLPSDSVVHFDLDAPDVIHSFWIPAFAFKMDAIPGHPNEFQVKIKPGVEGDYEGRCAELCGFDHSRMLFTLRVVTPDEYRAWIEEQKANPQELPASPDVQEETPAPDQGQDTASQDAAAQDSSDSAAAAEEEDGQ",
        "proteome": "UP000074382",
        "gene": "AC529_19110",
        "go_terms": [
            {
                "identifier": "GO:0022900",
                "name": "electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004129",
                "name": "cytochrome-c oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "88b60944f2de6b5d45ece24636a695a26d91384e",
        "counters": {
            "domain_architectures": 14503,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "profile": 2,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14503
        }
    }
}