GET /api/protein/UniProt/A0A143FY60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A143FY60",
"id": "A0A143FY60_ACOWR",
"source_organism": {
"taxId": "292681",
"scientificName": "Acoelorraphe wrightii",
"fullName": "Acoelorraphe wrightii (Everglades palm)"
},
"name": "NADH-quinone oxidoreductase subunit K",
"description": [
"NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
],
"length": 101,
"sequence": "MMFEHVLFLSVYLFSIGIYGLITSRKMVRALMCLELILNSVNINLVTFSDIFDSRQLKGDIFSIFVIAVAAAEAAIGLAIVSSIHRNRKSTRINQSNLLNN",
"proteome": null,
"gene": "ndhE",
"go_terms": [
{
"identifier": "GO:0016651",
"name": "oxidoreductase activity, acting on NAD(P)H",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042773",
"name": "ATP synthesis coupled electron transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5c384e151efd07be17d94f5774ea581a4dbdd6cf",
"counters": {
"domain_architectures": 70833,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ncbifam": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 70833
}
}
}