General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A135LKR7",
        "id": "A0A135LKR7_PENPA",
        "source_organism": {
            "taxId": "5078",
            "scientificName": "Penicillium patulum",
            "fullName": "Penicillium patulum"
        },
        "name": "chitinase",
        "description": [
            "GPI-anchored chitinase involved in the degradation of chitin, a component of the cell walls of fungi and exoskeletal elements of some animals (including worms and arthropods). Required to reshape the cell wall at the sites where cell wall remodeling and/or cell wall maturation actively take place such as sites of conidia formation"
        ],
        "length": 478,
        "sequence": "MGRYQGLIAWSIWLASLAGVEAKLDLNSTSNIVVYWGQNSFNGKGDQAQQPLAYYCDNKDIDVIPMAFNMMVNGPGGAPEIDFAVTSKDCEVFPGTQLKNCPAIGKDIKTCQSKGKTILLSIGGATYSEGGFKSEQEAKSGAKLMWETFGPKQEGSKALRPFGDAALDGFDFDFEANVQNMAIFANELRALMKADKSKQTFYLTAAPQCPYPDQADKDILNGPVYIDAIWVQFYNNYCGVNSFNKDISSSKYNFEEWDNWAKTVSVNKNVKVMIGVPAFTTAASTGYIPASELAKVIEYTKKFESLGGVMMWDATQAYGNNGFIKDVRNSLGPANDSGSSSPDPVSTSAPTSTSTDSTKTSLSSNAPVSSHSSSSFSSVSASPKEDEDIKEHNPAGPTTIGTAFITTITVENGHVATATPEATAAPTSSEDDPNKNHLSTIIGNDLLGLLGGIRKANIVAGNVAHSLIGLRHARRNRI",
        "proteome": "UP000070168",
        "gene": "PGRI_055440",
        "go_terms": [
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a2ad1651b3b92d27448bb949a62477964b0c4080",
        "counters": {
            "domain_architectures": 49712,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49712
        }
    }
}