HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A109DQQ3",
"id": "A0A109DQQ3_9LACO",
"source_organism": {
"taxId": "47770",
"scientificName": "Lactobacillus crispatus",
"fullName": "Lactobacillus crispatus"
},
"name": "CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase",
"description": [
"This protein catalyzes the committed step to the synthesis of the acidic phospholipids"
],
"length": 186,
"sequence": "MNLPNKLTVFRIFLIPVFMLIIIFGGNASVQAAGSTVVWSRVIAAIVFAVASATDWFDGHIARSRNMVTNFGKFADPLADKMLTMTAFIFLVELKLAPAWVVAIIVCRELAVTGLRLILAENEGQVLAAKMPGKIKTTCQMLSIIFLLIGDFFHIGTILLYLALIFTIYSGYDYFHQSWGVFKGSM",
"proteome": "UP001434419",
"gene": "pgsA",
"go_terms": [
{
"identifier": "GO:0016780",
"name": "phosphotransferase activity, for other substituted phosphate groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008444",
"name": "CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
"counters": {
"domain_architectures": 90890,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 90890
}
}
}