General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A101PC75",
        "id": "A0A101PC75_9ACTN",
        "source_organism": {
            "taxId": "67386",
            "scientificName": "Streptomyces yokosukanensis",
            "fullName": "Streptomyces yokosukanensis"
        },
        "name": "NADH-quinone oxidoreductase subunit K",
        "description": [
            "NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
        ],
        "length": 99,
        "sequence": "MNPVNYLYLAALLFTIGATGVLIRRNAIVVFMCIELMLNACNLAFVTFSRMHGNLDGQIIAFFTMVVAAAEVVVGLAIIVSLFRTRHSASVDDASLMKL",
        "proteome": "UP000053127",
        "gene": "nuoK",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042773",
                "name": "ATP synthesis coupled electron transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5c384e151efd07be17d94f5774ea581a4dbdd6cf",
        "counters": {
            "domain_architectures": 70833,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ncbifam": 3,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70833
        }
    }
}