GET /api/protein/UniProt/A0A0X8F839/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0X8F839",
        "id": "A0A0X8F839_9LACT",
        "source_organism": {
            "taxId": "87541",
            "scientificName": "Aerococcus christensenii",
            "fullName": "Aerococcus christensenii"
        },
        "name": "Transcription termination factor Rho",
        "description": [
            "Facilitates transcription termination by a mechanism that involves Rho binding to the nascent RNA, activation of Rho's RNA-dependent ATPase activity, and release of the mRNA from the DNA template"
        ],
        "length": 431,
        "sequence": "MAKKEGKTYEKDEVVTLASLSEQTLKQIYTYARQYKIPNYSKMTKKELSLAVVRAQGESKGYFPVEGVLDITGPEFGFLYPINYSASQEDIYISSTQINRFGLRNGDLIKGLARPPKERERRNGLLQIATVNGKDPELAKERDHFPALTPIYPDRLMKLETDADKLSLRMIDLLSPIGFGQRGLIAAPPKAGKTVLLKQVANAIATNYPEVVLIVLLIDERPEEVTDFERNVQAEVVASTFDQHPRNHIQVAELVIERAKRLVEDKQDVVVLIDSLTRLVRAYNNVEPPSGRTMSGGLDPVALNGPKKIFGSARNIEGGGSLTILATALIQTDSKADEVIYEEFKGTGNMELHLDRSLAQSRIFPAIDVNKSGTRKEDLLLDTQTLEAAYNLRQLMTGNLKEDTRQLLMTFESIVSNQELIEKILVKKGKK",
        "proteome": "UP000234775",
        "gene": "rho",
        "go_terms": [
            {
                "identifier": "GO:0006353",
                "name": "DNA-templated transcription termination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008186",
                "name": "ATP-dependent activity, acting on RNA",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b41e4198d6bf84cafd11242c8eb0741bd21b3f4",
        "counters": {
            "domain_architectures": 19643,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "smart": 3,
                "pfam": 3,
                "profile": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19643
        }
    }
}