HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0X8F839",
"id": "A0A0X8F839_9LACT",
"source_organism": {
"taxId": "87541",
"scientificName": "Aerococcus christensenii",
"fullName": "Aerococcus christensenii"
},
"name": "Transcription termination factor Rho",
"description": [
"Facilitates transcription termination by a mechanism that involves Rho binding to the nascent RNA, activation of Rho's RNA-dependent ATPase activity, and release of the mRNA from the DNA template"
],
"length": 431,
"sequence": "MAKKEGKTYEKDEVVTLASLSEQTLKQIYTYARQYKIPNYSKMTKKELSLAVVRAQGESKGYFPVEGVLDITGPEFGFLYPINYSASQEDIYISSTQINRFGLRNGDLIKGLARPPKERERRNGLLQIATVNGKDPELAKERDHFPALTPIYPDRLMKLETDADKLSLRMIDLLSPIGFGQRGLIAAPPKAGKTVLLKQVANAIATNYPEVVLIVLLIDERPEEVTDFERNVQAEVVASTFDQHPRNHIQVAELVIERAKRLVEDKQDVVVLIDSLTRLVRAYNNVEPPSGRTMSGGLDPVALNGPKKIFGSARNIEGGGSLTILATALIQTDSKADEVIYEEFKGTGNMELHLDRSLAQSRIFPAIDVNKSGTRKEDLLLDTQTLEAAYNLRQLMTGNLKEDTRQLLMTFESIVSNQELIEKILVKKGKK",
"proteome": "UP000234775",
"gene": "rho",
"go_terms": [
{
"identifier": "GO:0006353",
"name": "DNA-templated transcription termination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008186",
"name": "ATP-dependent activity, acting on RNA",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b41e4198d6bf84cafd11242c8eb0741bd21b3f4",
"counters": {
"domain_architectures": 19643,
"entries": 28,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"smart": 3,
"pfam": 3,
"profile": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19643
}
}
}