GET /api/protein/UniProt/A0A0U3LVC0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0U3LVC0",
"id": "A0A0U3LVC0_STRGL",
"source_organism": {
"taxId": "1172567",
"scientificName": "Streptomyces globisporus C-1027",
"fullName": "Streptomyces globisporus C-1027"
},
"name": "Ribonucleoside-diphosphate reductase subunit beta",
"description": [
"Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides"
],
"length": 339,
"sequence": "MSTTSNEKNLLDPGFELTLRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVADLAKLSPGEQHMIGRLVAFFATGDSIVSNNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPDPDDRAAAFDAVEEIPSIREKAQFCFKWMDSVEKIERLETKADRRRFLLNLICFAACIEGLFFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMNFAFEVVDTVRKEEPELFDDALQQQVTDMLKEAVEAELQFGRDLCGEGLPGMNTESMRQYLECVADQRLARLGFPTVYGSENPFSFMELQGVQELTNFFERRPSAYQVAVEGSVGFDDDF",
"proteome": null,
"gene": "WQO_24035",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009263",
"name": "deoxyribonucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f7bbeeb2f0b1133f990124cc28648cd94c6d792c",
"counters": {
"domain_architectures": 34662,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 34662
}
}
}