HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0U2DV70",
"id": "A0A0U2DV70_AMEAR",
"source_organism": {
"taxId": "25625",
"scientificName": "Amentotaxus argotaenia",
"fullName": "Amentotaxus argotaenia (Chinese flowering yew)"
},
"name": "Cytochrome b559 subunit beta",
"description": [
"This b-type cytochrome is tightly associated with the reaction center of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation"
],
"length": 39,
"sequence": "MTIDRTYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR",
"proteome": null,
"gene": "psbF",
"go_terms": [
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009767",
"name": "photosynthetic electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019684",
"name": "photosynthesis, light reaction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009523",
"name": "photosystem II",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009539",
"name": "photosystem II reaction center",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2fe306c18dc19431498253f8752a8d452970f634",
"counters": {
"domain_architectures": 14154,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 14154
}
}
}