GET /api/protein/UniProt/A0A0U2DDL6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0U2DDL6",
"id": "A0A0U2DDL6_9CAUD",
"source_organism": {
"taxId": "1655305",
"scientificName": "Escherichia phage APCEc01",
"fullName": "Escherichia phage APCEc01"
},
"name": "Sliding-clamp-loader small subunit",
"description": [
"Forms the sliding-clamp-loader together with the small subunit. The clamp loader holds the clamp in an open conformation and places it onto the DNA"
],
"length": 187,
"sequence": "MNLFDDDVQLNEHQIAWKSNDADAIQKCADMFKEKPENEFFKIINAINEKKSMSIAQVDYSKFMVENSLSQFPECMPAVYMMNLVGSELSDEAHFNYMMAAIPRGRRFSKWAKLVEDTSELLVIKLLMKHYTINMNDATEYKRLLEKNNKLPIVLKELKAMVTDEFLKEVTKNVKEQKQFKKLALEW",
"proteome": "UP000202243",
"gene": "APCEc01_248",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "8f05764eb4c66de34afe64bcb95239199ba59faa",
"counters": {
"domain_architectures": 608,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 1,
"hamap": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 608
}
}
}