HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0U1HU51",
"id": "A0A0U1HU51_YERRO",
"source_organism": {
"taxId": "29485",
"scientificName": "Yersinia rohdei",
"fullName": "Yersinia rohdei"
},
"name": "Protoporphyrinogen IX dehydrogenase [quinone]",
"description": [
"Catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX; under anaerobic conditions uses menaquinone as an electron acceptor, under aerobic conditions uses ubiquinone as an electron acceptor"
],
"length": 177,
"sequence": "MNILILYSSRDGQTKTIASYIAKELSATATCEIQDLADVAQIDLSKYQQVMIGASVRYGHFNPSLNKFVNKHIAQLNQMPSAFFAVNLTARKPEKRSPQTNAYVRKFLLSTPWQPTLCSVFAGALRYPRYRWIDRVMIQLIMRMTGGETDTSKEVEYTDWQQVSSFAQDFSALSYEK",
"proteome": "UP000031914",
"gene": "hemG",
"go_terms": [
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004729",
"name": "oxygen-dependent protoporphyrinogen oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0070819",
"name": "menaquinone-dependent protoporphyrinogen oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006782",
"name": "protoporphyrinogen IX biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006783",
"name": "heme biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "73266f6e74446e0121c968373654bd0454ce15cc",
"counters": {
"domain_architectures": 8452,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8452
}
}
}