HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0S8FP37",
"id": "A0A0S8FP37_UNCW3",
"source_organism": {
"taxId": "1703779",
"scientificName": "candidate division WOR_3 bacterium SM23_42",
"fullName": "candidate division WOR_3 bacterium SM23_42"
},
"name": "Chromosomal replication initiator protein DnaA",
"description": [
"Plays an essential role in the initiation and regulation of chromosomal replication. ATP-DnaA binds to the origin of replication (oriC) to initiate formation of the DNA replication initiation complex once per cell cycle. Binds the DnaA box (a 9 base pair repeat at the origin) and separates the double-stranded (ds)DNA. Forms a right-handed helical filament on oriC DNA; dsDNA binds to the exterior of the filament while single-stranded (ss)DNA is stabiized in the filament's interior. The ATP-DnaA-oriC complex binds and stabilizes one strand of the AT-rich DNA unwinding element (DUE), permitting loading of DNA polymerase. After initiation quickly degrades to an ADP-DnaA complex that is not apt for DNA replication. Binds acidic phospholipids"
],
"length": 440,
"sequence": "MTEQAKKTWDKILQYLKERINPQSFTTWFGSSHGVELKDDVLLVEFPNGFFIDWIEEHYCSILEEAVNHVNGEKLRVAFKAVRQSGDRPIRKKKRLILSHASTKLQERYTFQTFVVGKSNEFAHAAALAVAEAPGQAYNPLFLYGGVGLGKTHLMQAIGNFAHRQYKSLSIYYTQAENIMTELIEAIQKNQQMAFKKKYRTKDLLLIDDIQFLFGKERLQEEIFHTFNYLYTQGKQIVISSDRPPKEIPTIEERLTSRFQGGLVVDLQPPDLETRIAILQKKAEFENIRIPSNVAYYIASRVKSNIRELEGCLIRLLAMSSLSGEEVTEQLTESVLKDLLNHGGKVTKEMILRNVVDEFGFTEAELKGKKRTQKLALARQTSMYIIRNLLSLSLTEIGDFFGGKDHTTVMHAIDKVENLKKTDFEYSQKLQGIITRINSV",
"proteome": null,
"gene": "dnaA",
"go_terms": [
{
"identifier": "GO:0043565",
"name": "sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006270",
"name": "DNA replication initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006275",
"name": "regulation of DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003688",
"name": "DNA replication origin binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "af048913435faf44e3cf5dbae4bb1e79c0668ce6",
"counters": {
"domain_architectures": 17631,
"entries": 28,
"isoforms": 0,
"proteomes": 0,
"sets": 5,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 4,
"pfam": 3,
"ssf": 2,
"cdd": 2,
"smart": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17631
}
}
}