GET /api/protein/UniProt/A0A0S8FP37/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0S8FP37",
        "id": "A0A0S8FP37_UNCW3",
        "source_organism": {
            "taxId": "1703779",
            "scientificName": "candidate division WOR_3 bacterium SM23_42",
            "fullName": "candidate division WOR_3 bacterium SM23_42"
        },
        "name": "Chromosomal replication initiator protein DnaA",
        "description": [
            "Plays an essential role in the initiation and regulation of chromosomal replication. ATP-DnaA binds to the origin of replication (oriC) to initiate formation of the DNA replication initiation complex once per cell cycle. Binds the DnaA box (a 9 base pair repeat at the origin) and separates the double-stranded (ds)DNA. Forms a right-handed helical filament on oriC DNA; dsDNA binds to the exterior of the filament while single-stranded (ss)DNA is stabiized in the filament's interior. The ATP-DnaA-oriC complex binds and stabilizes one strand of the AT-rich DNA unwinding element (DUE), permitting loading of DNA polymerase. After initiation quickly degrades to an ADP-DnaA complex that is not apt for DNA replication. Binds acidic phospholipids"
        ],
        "length": 440,
        "sequence": "MTEQAKKTWDKILQYLKERINPQSFTTWFGSSHGVELKDDVLLVEFPNGFFIDWIEEHYCSILEEAVNHVNGEKLRVAFKAVRQSGDRPIRKKKRLILSHASTKLQERYTFQTFVVGKSNEFAHAAALAVAEAPGQAYNPLFLYGGVGLGKTHLMQAIGNFAHRQYKSLSIYYTQAENIMTELIEAIQKNQQMAFKKKYRTKDLLLIDDIQFLFGKERLQEEIFHTFNYLYTQGKQIVISSDRPPKEIPTIEERLTSRFQGGLVVDLQPPDLETRIAILQKKAEFENIRIPSNVAYYIASRVKSNIRELEGCLIRLLAMSSLSGEEVTEQLTESVLKDLLNHGGKVTKEMILRNVVDEFGFTEAELKGKKRTQKLALARQTSMYIIRNLLSLSLTEIGDFFGGKDHTTVMHAIDKVENLKKTDFEYSQKLQGIITRINSV",
        "proteome": null,
        "gene": "dnaA",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006270",
                "name": "DNA replication initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006275",
                "name": "regulation of DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003688",
                "name": "DNA replication origin binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af048913435faf44e3cf5dbae4bb1e79c0668ce6",
        "counters": {
            "domain_architectures": 17631,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 4,
                "pfam": 3,
                "ssf": 2,
                "cdd": 2,
                "smart": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 10
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 17631
        }
    }
}