GET /api/protein/UniProt/A0A0S3R688/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0S3R688",
        "id": "A0A0S3R688_PHAAN",
        "source_organism": {
            "taxId": "157739",
            "scientificName": "Vigna angularis var. angularis",
            "fullName": "Vigna angularis var. angularis"
        },
        "name": "Amino acid transporter transmembrane domain-containing protein",
        "description": [
            "Carrier protein involved in proton-driven auxin influx. Mediates the formation of auxin gradient from developing leaves (site of auxin biosynthesis) to tips by contributing to the loading of auxin in vascular tissues and facilitating acropetal (base to tip) auxin transport within inner tissues of the root apex, and basipetal (tip to base) auxin transport within outer tissues of the root apex. May be involved in lateral roots and nodules formation"
        ],
        "length": 443,
        "sequence": "MDVEGRGTLNIEQGQEKGTQNNDSGLATAHTIDSDSWKQVGLMLVTTFNCGWILSFSNLIMWPLGWTWGIICLLLVGLYTAYANWLLAAFHFVDNRRFIRYRDLMGYVYGKGMYHITWVFQFLTLLLGNMGFILLGGKALKEINSEFSDSPLRLQYYIVITGAAYFLYSFSIPTMSAMKNWLGVSAGLTFTYIVFLLFVLEKDGKSNSNRDFDISGSQVSKVFNSFGAISAIVVANTSGLLPEIQSTLRKPAVKNMRKALYLQYTVGVVFYYGVLVMGYWAYGSAVSAYLPENLSGPKWINVLINAIVFLQSIVSQHMFVAPILEALDTKFLEIDMPMHSGENLKRLFLLRAFFFTGNTFVAAAFPFMGDFVNFLGSFSLIPLTFMFPSMLFIKVKGRTASIEKKAWHWFNIVFSFLLTIATTISAVRLIVDNIQKYHFFADA",
        "proteome": "UP000291084",
        "gene": "Vigan.01G396200",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "563bf97a90fdce69b83f48705e7686854a329061",
        "counters": {
            "domain_architectures": 91119,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 91119
        }
    }
}