GET /api/protein/UniProt/A0A0S2UQ08/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0S2UQ08",
"id": "A0A0S2UQ08_MUMPV",
"source_organism": {
"taxId": "1395183",
"scientificName": "Mumps virus genotype N",
"fullName": "Mumps virus genotype N"
},
"name": "Small hydrophobic protein",
"description": [
"Plays a role in the inhibition of the host NF-kappa-B pathway. This inhibition occurs at the receptor level, by preventing the signaling of TNFR1 as well as IL-1R and TLR3"
],
"length": 57,
"sequence": "MPAIQPPLYLTFLLLILLYLIITLYVWIILTITYKTAVRHAALHQRSFFRWSFDHSL",
"proteome": null,
"gene": "SH",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "ae51987f799c2f3f0282c85eeab9a0295ae9e58e",
"counters": {
"domain_architectures": 941,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 941
}
}
}