GET /api/protein/UniProt/A0A0S2UQ08/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0S2UQ08",
        "id": "A0A0S2UQ08_MUMPV",
        "source_organism": {
            "taxId": "1395183",
            "scientificName": "Mumps virus genotype N",
            "fullName": "Mumps virus genotype N"
        },
        "name": "Small hydrophobic protein",
        "description": [
            "Plays a role in the inhibition of the host NF-kappa-B pathway. This inhibition occurs at the receptor level, by preventing the signaling of TNFR1 as well as IL-1R and TLR3"
        ],
        "length": 57,
        "sequence": "MPAIQPPLYLTFLLLILLYLIITLYVWIILTITYKTAVRHAALHQRSFFRWSFDHSL",
        "proteome": null,
        "gene": "SH",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "ae51987f799c2f3f0282c85eeab9a0295ae9e58e",
        "counters": {
            "domain_architectures": 941,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 941
        }
    }
}