GET /api/protein/UniProt/A0A0S2MME7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0S2MME7",
        "id": "A0A0S2MME7_9PRIM",
        "source_organism": {
            "taxId": "767356",
            "scientificName": "Lagothrix poeppigii",
            "fullName": "Lagothrix poeppigii (silvery woolly monkey)"
        },
        "name": "Oxytocin receptor",
        "description": [
            "Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system"
        ],
        "length": 389,
        "sequence": "MEGAFAANWSAEEVNASAVPPGSEGNRTSGPPQRDEALARVEVAVLSLILFLALSGNACVLLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQMHIFSLREVAEGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAVVGAGGRMALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDVNAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSSSYLKGNRLGETSASKKSNSSSFVLSHRNSSQRSCSQPSVA",
        "proteome": null,
        "gene": "OXTR",
        "go_terms": [
            {
                "identifier": "GO:0004990",
                "name": "oxytocin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005000",
                "name": "vasopressin receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 394800,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 3,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 394800
        }
    }
}