GET /api/protein/UniProt/A0A0S2LMH5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0S2LMH5",
        "id": "A0A0S2LMH5_TAMTE",
        "source_organism": {
            "taxId": "48850",
            "scientificName": "Tamandua tetradactyla",
            "fullName": "Tamandua tetradactyla (Southern anteater)"
        },
        "name": "NADH-ubiquinone oxidoreductase chain 4L",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Part of the enzyme membrane arm which is embedded in the lipid bilayer and involved in proton translocation"
        ],
        "length": 98,
        "sequence": "MSSIYMNILLAFTMALLGLLMYRSHLMSSLLCLEGMMLSLFILSTVTMLNTSFTLSSMMPVMLMVFAACEAAVGLALLVTVSNTYGLDYVQNLNLLQC",
        "proteome": null,
        "gene": "ND4L",
        "go_terms": [
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042773",
                "name": "ATP synthesis coupled electron transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5c384e151efd07be17d94f5774ea581a4dbdd6cf",
        "counters": {
            "domain_architectures": 70833,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 70833
        }
    }
}