GET /api/protein/UniProt/A0A0R9PVU6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0R9PVU6",
"id": "A0A0R9PVU6_SALNE",
"source_organism": {
"taxId": "108619",
"scientificName": "Salmonella newport",
"fullName": "Salmonella newport"
},
"name": "GDP-mannose pyrophosphatase",
"description": [
"Nucleoside diphosphate sugar hydrolase that hydrolyzes GDP-mannose as its preferred substrate, yielding GMP and mannose-1-phosphate"
],
"length": 191,
"sequence": "MSQTITLIKDKILSDNYFTLRNITYDLTRRNGEVIRHRREVYDRGNGATILLYNSTKKTVVLVRQFRVATWVNGNQDGMLIETCAGLLDNDEPEVCIRKEAIEETGYDVGEVRKIFELYMSPGGVTELIHFFIAEYHDSERASIGGGVEDEEIEVLELPFSRALEMVRSGEIRDGKTVLLLNYLQTSHLMD",
"proteome": null,
"gene": "nudK",
"go_terms": [
{
"identifier": "GO:0016818",
"name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c7bf1762d1bc5655a2b76df9dc1b729736bd9b68",
"counters": {
"domain_architectures": 4433,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 2,
"ssf": 1,
"cdd": 1,
"profile": 1,
"ncbifam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4433
}
}
}