HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0R2JMH0",
"id": "A0A0R2JMH0_9LACO",
"source_organism": {
"taxId": "1122148",
"scientificName": "Fructilactobacillus lindneri DSM 20690 = JCM 11027",
"fullName": "Fructilactobacillus lindneri DSM 20690 = JCM 11027"
},
"name": "Aspartokinase",
"description": [
"Catalyzes the phosphorylation of the beta-carboxyl group of aspartic acid with ATP to yield 4-phospho-L-aspartate, which is involved in the branched biosynthetic pathway leading to the biosynthesis of amino acids threonine, isoleucine and methionine"
],
"length": 456,
"sequence": "MKVVKFGGSSLADGNHFEQIIKIIKADPERKAVVVSAPGTRFKGDIKVTDLLIQYANAVLANEDYQELQQAIIARYQNITEHFQLDSSILAKITQTIKQLPFQNYPNDDYLMAGFKAQGEYLNAYTLSQVLNQIGIKTKFMDPRKIGFLVSDKAQDAHVLPDTYDNLEKYPNTDIHLIFPGFFGITKDNQIATFSRGGSDITGSIVAKGLNASVYENFTDVNAIYSVDPHIVKDPTSIHVMTYREMRELSYAGFSVFHDEAIIPAIEAKIPINVKNTSHPELPGTMIIPENEFEPTNLITGVASSKGFSALYLHRYLLNKEVGFTLKILQILYKYDVSYEHMPSGIDDLTIIFDNKQLTPAKKEKICAEINAALHPDQLEWIDNYAIIMIVGEGMQKSSATIENIIRPLTDHDIKIHMINQGASKIALMLGTDDADAEKSVKLIYQHFFDNNRIVN",
"proteome": "UP000051565",
"gene": "IV52_GL001170",
"go_terms": [
{
"identifier": "GO:0004072",
"name": "aspartate kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008652",
"name": "amino acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009089",
"name": "L-lysine biosynthetic process via diaminopimelate",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eb4029f2965581c7440d813b6cc283131f648fe4",
"counters": {
"domain_architectures": 12628,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"ssf": 2,
"cathgene3d": 3,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12628
}
}
}