HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0N8S3F3",
"id": "A0A0N8S3F3_9PSED",
"source_organism": {
"taxId": "86176",
"scientificName": "Pseudomonas meliae",
"fullName": "Pseudomonas meliae"
},
"name": "HTH-type transcriptional regulator BetI",
"description": [
"Repressor involved in choline regulation of the bet genes",
"Repressor involved in the biosynthesis of the osmoprotectant glycine betaine. It represses transcription of the choline transporter BetT and the genes of BetAB involved in the synthesis of glycine betaine"
],
"length": 197,
"sequence": "MPKVGMQPIRRQQLIQATLTAVDQVGMGDASIALIARLAGVSNGIISHYFQDKNGLIAATMRHLMNALIQNVRERRQALTEDSPRAHLQVIIEGNFDASQVSGPAMKTWLAFWATSMHHPSLHRLQRINDHRLYSNLCCQFRRTLPLEQARSAARGLAALIDGLWLRGALSGDAFDTEQAQRIAYEYMDFQLAKSAS",
"proteome": "UP000050455",
"gene": "betI",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "66725821d7df97a42b393f54e0e54b7da3bfed7f",
"counters": {
"domain_architectures": 28426,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 1,
"profile": 1,
"pfam": 2,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28426
}
}
}