HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0N7F227",
"id": "A0A0N7F227_RABIT",
"source_organism": {
"taxId": "568996",
"scientificName": "Oryctolagus cuniculus cuniculus",
"fullName": "Oryctolagus cuniculus cuniculus"
},
"name": "Interleukin-12 subunit alpha",
"description": [
"Heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to form the IL-35 cytokine. IL-12 is primarily produced by professional antigen-presenting cells (APCs) such as B-cells and dendritic cells (DCs) as well as macrophages and granulocytes and regulates T-cell and natural killer-cell responses, induces the production of interferon-gamma (IFN-gamma), favors the differentiation of T-helper 1 (Th1) cells and is an important link between innate resistance and adaptive immunity. Mechanistically, exerts its biological effects through a receptor composed of IL12R1 and IL12R2 subunits. Binding to the receptor results in the rapid tyrosine phosphorylation of a number of cellular substrates including the JAK family kinases TYK2 and JAK2. In turn, recruited STAT4 gets phosphorylated and translocates to the nucleus where it regulates cytokine/growth factor responsive genes. As part of IL-35, plays essential roles in maintaining the immune homeostasis of the liver microenvironment and functions also as an immune-suppressive cytokine. Mediates biological events through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers. Signaling requires the transcription factors STAT1 and STAT4, which form a unique heterodimer that binds to distinct DNA sites"
],
"length": 219,
"sequence": "MCSLRGLLLVSTLVLLNGLSLARNLPVATPDLGLFQCLNHSQNLLRAVSDTLHKARQTLEFYSCTSEEIDHEDITKDKTSTVKACLPLELTKNESCLASRETSLIINGSCLSSGKTSSMVTLCLSSIYEDLKMYQVEFMAMNAKLLMDSKRQIFLDQDMLGAIEELMQALNSNSGAVPQNPSLEELDFYKTKIKLCILLHAFRIRVVTIDRMMSYLSSS",
"proteome": null,
"gene": "IL12A",
"go_terms": [
{
"identifier": "GO:0005143",
"name": "interleukin-12 receptor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d02be9acf0addf333f6cf781767ffd9f0d534759",
"counters": {
"domain_architectures": 734,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 734
}
}
}
