GET /api/protein/UniProt/A0A0L9Z2B4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0L9Z2B4",
        "id": "A0A0L9Z2B4_CLOBO",
        "source_organism": {
            "taxId": "1491",
            "scientificName": "Clostridium botulinum",
            "fullName": "Clostridium botulinum"
        },
        "name": "UPF0122 protein FC794_17235",
        "description": [
            "Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein"
        ],
        "length": 110,
        "sequence": "MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIKKYIIDNI",
        "proteome": null,
        "gene": "FC794_17235",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "359fb5b06e8ba1341092b7594cbdf649b4ed6456",
        "counters": {
            "domain_architectures": 4998,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 3,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4998
        }
    }
}