GET /api/protein/UniProt/A0A0L9Z2B4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0L9Z2B4",
"id": "A0A0L9Z2B4_CLOBO",
"source_organism": {
"taxId": "1491",
"scientificName": "Clostridium botulinum",
"fullName": "Clostridium botulinum"
},
"name": "UPF0122 protein FC794_17235",
"description": [
"Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein"
],
"length": 110,
"sequence": "MEEIVEMSLLLDFYGSLLTEKQNKIMDLYYNNDYSLKEISELTNTSRQAVHDIVKRCHKALLQYEEKLHMMERFINLENSKEKLLNMLNKVTKENIKEIDHIKKYIIDNI",
"proteome": null,
"gene": "FC794_17235",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "359fb5b06e8ba1341092b7594cbdf649b4ed6456",
"counters": {
"domain_architectures": 4998,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 3,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4998
}
}
}