GET /api/protein/UniProt/A0A0L7QXM4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0L7QXM4",
        "id": "A0A0L7QXM4_9HYME",
        "source_organism": {
            "taxId": "597456",
            "scientificName": "Habropoda laboriosa",
            "fullName": "Habropoda laboriosa"
        },
        "name": "Membrane magnesium transporter",
        "description": [
            "Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. May be involved in Mg(2+) transport"
        ],
        "length": 127,
        "sequence": "MSNYRKQFLICDNIKMSATTVHKFITFIGLLSILHAAYSAAQHRSYLRITEQEFTTLPIDILIQGIASLFMVMYGVMYIAGDFKEIRAVVDLENKSWETLRNLPSFQIFNHRGRSLRRCNTYESNAL",
        "proteome": "UP000053825",
        "gene": "WH47_04758",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9e6ba804fc9271b98ec61997447775d85d4f123c",
        "counters": {
            "domain_architectures": 2983,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2983
        }
    }
}