GET /api/protein/UniProt/A0A0L1KEN5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0L1KEN5",
        "id": "A0A0L1KEN5_9SPHN",
        "source_organism": {
            "taxId": "1306953",
            "scientificName": "Qipengyuania citrea LAMA 915",
            "fullName": "Qipengyuania citrea LAMA 915"
        },
        "name": "Bifunctional protein GlmU",
        "description": [
            "Catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-N-acetylglucosamine (UDP-GlcNAc). The C-terminal domain catalyzes the transfer of acetyl group from acetyl coenzyme A to glucosamine-1-phosphate (GlcN-1-P) to produce N-acetylglucosamine-1-phosphate (GlcNAc-1-P), which is converted into UDP-GlcNAc by the transfer of uridine 5-monophosphate (from uridine 5-triphosphate), a reaction catalyzed by the N-terminal domain"
        ],
        "length": 454,
        "sequence": "MNMTRDFAAIVLAAGKGTRMKSDLHKVLHPIAGRPMLDHLLATVDALQPAKKVVVVGAGRDQLENALAGSAETCLQEPQLGTGHAVQQAEESLADHSGDVLVLYGDVPFVKGETMQAMLDRLHAEDRPKVVVLGFEPDDPGHYGRVIADADGRIDKMVEFKDASEEERACRLCNSGVMAARSADMFELLRRVGNDNAQGEYYLVDIVNIANADGDSCAVVSADTPAEVTGINSRAELARAEAQWQELKREEAMAEGVTLTAPDTVFFSWDTDLAADVTVEPHVVFGPRVSVARGARIRAFSHLEGARVGEGCSVGPYARLRPGAVMEKDSFVGNFVEMKQATLGEGAKASHLTYLGDAEVGAGANIGAGTITCNYDGYFKHKTVIGERAFIGSNSALIAPVRIGTDAIVAAGSAVSRDVGDGDLRMVRGEQVVKPGWADRFHDAMKKKKAADRK",
        "proteome": null,
        "gene": "glmU",
        "go_terms": [
            {
                "identifier": "GO:0003977",
                "name": "UDP-N-acetylglucosamine diphosphorylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019134",
                "name": "glucosamine-1-phosphate N-acetyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006048",
                "name": "UDP-N-acetylglucosamine biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000902",
                "name": "cell morphogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009252",
                "name": "peptidoglycan biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "620da5db4462d76dbc95a6c8a4a919c7d44b9408",
        "counters": {
            "domain_architectures": 484,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 2,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 484
        }
    }
}