General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0L0HK48",
        "id": "A0A0L0HK48_SPIPD",
        "source_organism": {
            "taxId": "645134",
            "scientificName": "Spizellomyces punctatus (strain DAOM BR117)",
            "fullName": "Spizellomyces punctatus (strain DAOM BR117)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13",
        "description": [
            "Complex I functions in the transfer of electrons from NADH to the respiratory chain. Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis"
        ],
        "length": 173,
        "sequence": "MATVQDLPPQGGFPDTIQYKRYLPRRGPSGLVIFVAAFGVMGYGWYWVAKANAERRELRREKAWTRINLVPLLQAETDRDLIRRLEAAKKREGGVMENVQEWKPLDLKAPVPGVGKGGKFDAKQAEPVYHTDRYVNPSFLFMPWESDARMEAQWWRGTKMFLRVRKISCPASE",
        "proteome": "UP000053201",
        "gene": "SPPG_03217",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "10065c12fdcb9abecbc1f04adc54a4d52c5223b9",
        "counters": {
            "domain_architectures": 3729,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3729
        }
    }
}