General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0L0D4J4",
        "id": "A0A0L0D4J4_THETB",
        "source_organism": {
            "taxId": "461836",
            "scientificName": "Thecamonas trahens ATCC 50062",
            "fullName": "Thecamonas trahens ATCC 50062"
        },
        "name": "H/ACA ribonucleoprotein complex subunit",
        "description": [
            "Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine (\"psi\") residues may serve to stabilize the conformation of rRNAs"
        ],
        "length": 195,
        "sequence": "MSWRSRGGSRGGRGGRGGGRSYGGGRGGGGYNSGPPEAVAELGEFVHPCEGDLVFKSTNTMIPYFNAMVYSDNNALVGKIDDVLGAINSVMFTVKTAQGVQADSFKSGFKVYVDTQKLLPLSRFLPKPAGPKKPKSKAKRAGGGRGRGGRGGRGRGGSRFGGGRGGSRFGGGRGRGGGRGRGRGGSRGGWSQRRY",
        "proteome": "UP000054408",
        "gene": "AMSG_02674",
        "go_terms": [
            {
                "identifier": "GO:0001522",
                "name": "pseudouridine synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042254",
                "name": "ribosome biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ee64281510658e76b53b6adf410f200e6da51240",
        "counters": {
            "domain_architectures": 8956,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8956
        }
    }
}