GET /api/protein/UniProt/A0A0K2SFA3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0K2SFA3",
"id": "A0A0K2SFA3_9ALPC",
"source_organism": {
"taxId": "1264898",
"scientificName": "Ferret coronavirus",
"fullName": "Ferret coronavirus"
},
"name": "Envelope small membrane protein",
"description": [
"Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis"
],
"length": 82,
"sequence": "MKFPTLLTVIDDNGIVVNSIFWLLLIIVIILFSIALLNVIKLCQTCCRLTNVVIVLPAKQAYTAYKDFMSXPQAPDSVCLVV",
"proteome": null,
"gene": "E",
"go_terms": [
{
"identifier": "GO:0019068",
"name": "virion assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046760",
"name": "viral budding from Golgi membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "fe089b24b8342db75b5f45561e57c179de583659",
"counters": {
"domain_architectures": 981,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 981
}
}
}