GET /api/protein/UniProt/A0A0K1Y4X7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0K1Y4X7",
"id": "A0A0K1Y4X7_9CAUD",
"source_organism": {
"taxId": "1698360",
"scientificName": "Klebsiella phage JD18",
"fullName": "Klebsiella phage JD18"
},
"name": "Protein spackle",
"description": [
"Inhibits viral DNA ejection into the host cytoplasm, thereby confering the infected host bacteria with immunity against secondary phage infection. Achieves superinfection exclusion by localizing to the periplasm and inhibiting the activity of tail-associated lysozyme, thereby preventing penetration by the tail tube of incoming phages"
],
"length": 97,
"sequence": "MKKIVLALVFAVSSCSAVPAMANYDKDLCEWSMTADESEVAQQIRADVGHIVENVDPSKQSEVQAELKDDGAALKLNYVLYCDSQFDNFNIVKWILG",
"proteome": "UP000204179",
"gene": "JD18_014",
"go_terms": [
{
"identifier": "GO:0098669",
"name": "superinfection exclusion",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "24873de2cc339baf8a34ee253e4b666bac30f94d",
"counters": {
"domain_architectures": 216,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 216
}
}
}