GET /api/protein/UniProt/A0A0K0PUP8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0K0PUP8",
        "id": "A0A0K0PUP8_9ACTN",
        "source_organism": {
            "taxId": "887453",
            "scientificName": "Streptomyces incanus",
            "fullName": "Streptomyces incanus"
        },
        "name": "Protein RecA",
        "description": [
            "Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs"
        ],
        "length": 168,
        "sequence": "DVALGVGGLPRGRVVEVYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGEQALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALNQSKTTAIFINQLREKIGVMFGSPETTTGGRAL",
        "proteome": null,
        "gene": "recA",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140664",
                "name": "ATP-dependent DNA damage sensor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008094",
                "name": "ATP-dependent activity, acting on DNA",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006259",
                "name": "DNA metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003697",
                "name": "single-stranded DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "587eece09887d594749c5f5591ff82b2a75372d1",
        "counters": {
            "domain_architectures": 19842,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 19842
        }
    }
}