HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0K0PUP8",
"id": "A0A0K0PUP8_9ACTN",
"source_organism": {
"taxId": "887453",
"scientificName": "Streptomyces incanus",
"fullName": "Streptomyces incanus"
},
"name": "Protein RecA",
"description": [
"Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs"
],
"length": 168,
"sequence": "DVALGVGGLPRGRVVEVYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPDNGEQALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITSALNQSKTTAIFINQLREKIGVMFGSPETTTGGRAL",
"proteome": null,
"gene": "recA",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0140664",
"name": "ATP-dependent DNA damage sensor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008094",
"name": "ATP-dependent activity, acting on DNA",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006259",
"name": "DNA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003697",
"name": "single-stranded DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "587eece09887d594749c5f5591ff82b2a75372d1",
"counters": {
"domain_architectures": 19842,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"cathgene3d": 1,
"smart": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 19842
}
}
}