HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0K0LZM1",
"id": "A0A0K0LZM1_SOLCS",
"source_organism": {
"taxId": "59294",
"scientificName": "Solidago canadensis var. scabra",
"fullName": "Solidago canadensis var. scabra (Tall goldenrod)"
},
"name": "NAD(P)H-quinone oxidoreductase chain 4",
"description": [
"NDH-1 shuttles electrons from NAD(P)H, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient"
],
"length": 500,
"sequence": "MNKFPWLTIIVVLPIFAGSLIFFLPHKGNRVIRWYTICICMLELLLTTYAFCYHFQLDDPLIQLVDDYKWISFFDFRWKLGIDGLSIGPVLLTGFITTLATLAAWPITRDSRLFHFLMLAMYSGQIGSFSSRDLLLFFIMWELELIPVYLLLAMWGGKKRLYSATKFILYTAGGSIFLLMGVLGIGLYGSNEPTLNFETSVNQSYPVALEIIFYIGFFIAFAVKSPILPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLMIVGTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFILIGIASITDTGLNGAILQIISHGFIGAALFFLAGTSYDRIRLVYLDEMGGVAIPMPKIFTMFSSFSMASLALPGMSGFVAEVIVFLGLITSQKYLLMPKIAITFVMAIGMILTPIYLLSMSRQMFYGYKLFNTPNSYVFDSGPRELFVSISIFLPVIGIGMYPDFVLSLSVDKVEGILSNYFYR",
"proteome": null,
"gene": "ndhD",
"go_terms": [
{
"identifier": "GO:0016655",
"name": "oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008137",
"name": "NADH dehydrogenase (ubiquinone) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042773",
"name": "ATP synthesis coupled electron transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "30faf52ccf77815d26cefd5a8a86610417a47c43",
"counters": {
"domain_architectures": 148734,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 148734
}
}
}