General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0K0HBY8",
        "id": "A0A0K0HBY8_SALBC",
        "source_organism": {
            "taxId": "218493",
            "scientificName": "Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)",
            "fullName": "Salmonella bongori (strain ATCC 43975 / DSM 13772 / NCTC 12419)"
        },
        "name": "Flagellar protein FliT",
        "description": [
            "Dual-function protein that regulates the transcription of class 2 flagellar operons and that also acts as an export chaperone for the filament-capping protein FliD. As a transcriptional regulator, acts as an anti-FlhDC factor; it directly binds FlhC, thus inhibiting the binding of the FlhC/FlhD complex to class 2 promoters, resulting in decreased expression of class 2 flagellar operons. As a chaperone, effects FliD transition to the membrane by preventing its premature polymerization, and by directing it to the export apparatus"
        ],
        "length": 122,
        "sequence": "MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLEQEVSYLQSIETVMEKQTPPGITRSIQEMVAGYIKQTLDNEQRLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVPDAPNAS",
        "proteome": null,
        "gene": "fliT",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "61c7a9c0a0182d2c4c8e80c3c2432bbc928b5f68",
        "counters": {
            "domain_architectures": 5634,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5634
        }
    }
}