General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A0J9CDG8",
        "id": "A0A0J9CDG8_9FIRM",
        "source_organism": {
            "taxId": "742734",
            "scientificName": "[Clostridium] citroniae WAL-19142",
            "fullName": "[Clostridium] citroniae WAL-19142"
        },
        "name": "dihydrouracil dehydrogenase (NAD(+))",
        "description": [
            "Involved in pyrimidine base degradation. Catalyzes physiologically the reduction of uracil to 5,6-dihydrouracil (DHU) by using NADH as a specific cosubstrate. It also catalyzes the reverse reaction and the reduction of thymine to 5,6-dihydrothymine (DHT)"
        ],
        "length": 395,
        "sequence": "MSSMEVNVGGFKMKNPLMIASGPISSKLEHLKEAEENGFAAVSLKHTMAWQKFEAKPRWFFDSKIGVIVSGDPRLEPEYALDLIRKAKEQTELKIAVNLSGIPNQVESWGELSHMMEQAGADAIELNFNCPNLLTADAKTKAVLGANLGADPDSCRTVVAAVKQAVKIPVIAKLNTESGKLMPVSKAVAEAGADILNVHASYRSAPGLDIYHGGKMLYPGSEKGNFGAISGPWSKRASDRFICDVYWSNTGKAVIGGSGLYTWRDVVETIMYGASAVQMCVPVMQKGFGIGKEILDGLGRFMDECGYRSIDEMVGLATKYVCAPGEMDYGDITALVDETSCVGCRQCMPIAHCDAITYDSAAKKCAVDEDLCVGCGFCRGVCPKDAITYVLKKGK",
        "proteome": null,
        "gene": "HMPREF9470_01348",
        "go_terms": [
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0a0d7e59e49add4168f112f78932176109e299e2",
        "counters": {
            "domain_architectures": 87,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 87
        }
    }
}